About Us Careers Contact Us
Products
Inquiry List
  • Verification code
Our Highlights
  • Optimal Prices
    Buying products on this site guarantees the best price
  • Flexible Batches
    Flexible batch size to meet different needs of global customers
  • Prompt Delivery
    Warehouses in multiple cities to ensure timely delivery
  • Quality Assurance
    Strict process parameter control to ensure product quality
  • One-to-one Customization
    One-to-one custom synthesis for special structural needs
Application Area
Metabolic Research
Metabolic Research

Stable isotope labeling allows researchers to study metabolic pathways in vivo in a safe manner.

Environmental
Environmental

Stable isotope-labeled compounds are used as environmental pollutant standards for the detection of air, water, soil, sediment and food.

Clinical diagnostic
Clinical diagnostic

In addition to treating various diseases, isotopes are used for imaging, diagnosis, and newborn screening.

Organic Chemistry
Organic Chemistry

Small molecule compounds labeled with stable isotopes can be used as chemical reference for chemical identification, qualitative, quantitative, detection, etc. Various types of NMR solvents can be used to study the structure, reaction mechanism and reaction kinetics of compounds.

Metabolic Research
Metabolic Research

Stable isotope labeling allows researchers to study metabolic pathways in vivo in a safe manner.

Environmental
Environmental

Stable isotope-labeled compounds are used as environmental pollutant standards for the detection of air, water, soil, sediment and food.

pTH (1-34) (human)-[Leu15-13C6]

Inquiry
General Information
Catalog: BLP-014097
CAS: 1927927-15-8
Molecular Formula: C175[13C]6H291N55O51S2
Molecular Weight: 4123.71
Chemical Structure
pTH (1-34) (human)-[Leu15-13C6]
Description pTH (1-34) (human)-[Leu15-13C6] is the labelled analogue of pTH (1-34) (human), which is an effective anabolic (i.e., bone growing) agent used in the treatment of some forms of osteoporosis.
Synonyms ([13C6]Leu15)-Teriparatide; H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-[13C6]Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; ([13C6]Leu15)-pTH (1-34) (human); L-seryl-L-valyl-L-seryl-L-α-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-[13C6]-L-asparaginyl-L-seryl-L-methionyl-L-α-glutamyl-L-arginyl-L-valyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-valyl-L-histidyl-L-asparaginyl-L-Phenylalanine; Parathar-13C6; Teriparatida-13C6; Forteo-13C6
Related CAS 52232-67-4 (unlabelled) 99294-94-7 (unlabelled acetate)
Purity ≥95%
Solubility Soluble in DMSO, Water
Appearance White Powder
Storage Store at -20°C
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Related Products
Levocetirizine-[d4](CAS: 1133210-23-7)

Levocetirizine-[d4] is the labelled analogue of Levocetirizine, which is a histamine H1 receptor antagonist and could be used as an antihystaminic agent.

Famotidine-[13C](CAS: 2140271-21-0)

Famotidine-[13C] is the labelled analogue of Famotidine. Famotidine is a histamine H2 receptor antagonist that inhibits stomach acid production. It can be used ...

Erlotinib-[13C6] Hydrochloride(CAS: 1210610-07-3)

Erlotinib-[13C6] Hydrochloride is the labelled salt of Erlotinib. Erlotinib is a tyrosine kinase inhibitor which acts on the epidermal growth factor receptor (E...

Lamotrigine-[13C2,15N]

Lamotrigine-[13C2,15N] is the labelled analogue of Lamotrigine, which is used as a radiolabelled internal standard. Lamotrigine is an anticonvulsant, which inhi...

Banoxantrone-[d12](CAS: 1562067-05-3)

Banoxantrone-[d12] is the labelled analogue of Banoxantrone, which is a potent topoisomerase II inhibitor.

1-O-acetyl 2,3,5-tri-O-benzoyl-β-D-ribofuranoside-[1-13C]

1-O-acetyl 2,3,5-tri-O-benzoyl-β-D-ribofuranoside-[1-13C] is the labelled analogue of 1-O-Acetyl-2,3,5-tri-O-benzoyl-β-D-ribofuranose, which is an inhibitor of ...

Levocetirizine-[d4](CAS: 1133210-23-7)

Levocetirizine-[d4] is the labelled analogue of Levocetirizine, which is a histamine H1 receptor antagonist and could be used as an antihystaminic agent.

Famotidine-[13C](CAS: 2140271-21-0)

Famotidine-[13C] is the labelled analogue of Famotidine. Famotidine is a histamine H2 receptor antagonist that inhibits stomach acid production. It can be used ...

Erlotinib-[13C6] Hydrochloride(CAS: 1210610-07-3)

Erlotinib-[13C6] Hydrochloride is the labelled salt of Erlotinib. Erlotinib is a tyrosine kinase inhibitor which acts on the epidermal growth factor receptor (E...

Lamotrigine-[13C2,15N]

Lamotrigine-[13C2,15N] is the labelled analogue of Lamotrigine, which is used as a radiolabelled internal standard. Lamotrigine is an anticonvulsant, which inhi...

Banoxantrone-[d12](CAS: 1562067-05-3)

Banoxantrone-[d12] is the labelled analogue of Banoxantrone, which is a potent topoisomerase II inhibitor.

1-O-acetyl 2,3,5-tri-O-benzoyl-β-D-ribofuranoside-[1-13C]

1-O-acetyl 2,3,5-tri-O-benzoyl-β-D-ribofuranoside-[1-13C] is the labelled analogue of 1-O-Acetyl-2,3,5-tri-O-benzoyl-β-D-ribofuranose, which is an inhibitor of ...

Interested in our Service & Products?
Need detailed information?

USA
  • International: 1-631-504-6093
  • US & Canada (Toll free): 1-844-BOC(262)-0123
  • 45-16 Ramsey Road, Shirley, NY 11967, USA
  • Email: info@bocsci.com
  • Fax: 1-631-614-7828
UK
  • 44-20-3286-1088
  • 85 Great Portland Street, London, W1W 7LT
  • Email: info@bocsci.com
Navigation
Copyright © 2025 BOC Sciences. All Rights Reserved.
0
Inquiry Basket

No data available, please add!

Delete selectedGo to checkout

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x