About Us Careers Contact Us
Products
Inquiry List
  • Verification code
Our Highlights
  • Optimal Prices
    Buying products on this site guarantees the best price
  • Flexible Batches
    Flexible batch size to meet different needs of global customers
  • Prompt Delivery
    Warehouses in multiple cities to ensure timely delivery
  • Quality Assurance
    Strict process parameter control to ensure product quality
  • One-to-one Customization
    One-to-one custom synthesis for special structural needs
Application Area
Environmental
Environmental

Stable isotope-labeled compounds are used as environmental pollutant standards for the detection of air, water, soil, sediment and food.

Clinical diagnostic
Clinical diagnostic

In addition to treating various diseases, isotopes are used for imaging, diagnosis, and newborn screening.

Organic Chemistry
Organic Chemistry

Small molecule compounds labeled with stable isotopes can be used as chemical reference for chemical identification, qualitative, quantitative, detection, etc. Various types of NMR solvents can be used to study the structure, reaction mechanism and reaction kinetics of compounds.

Metabolic Research
Metabolic Research

Stable isotope labeling allows researchers to study metabolic pathways in vivo in a safe manner.

pTH (1-34) (human)-[Leu15-13C6]

Inquiry
General Information
Catalog: BLP-014097
CAS: 1927927-15-8
Molecular Formula: C175[13C]6H291N55O51S2
Molecular Weight: 4123.71
Chemical Structure
pTH (1-34) (human)-[Leu15-13C6]
Description pTH (1-34) (human)-[Leu15-13C6] is the labelled analogue of pTH (1-34) (human), which is an effective anabolic (i.e., bone growing) agent used in the treatment of some forms of osteoporosis.
Synonyms ([13C6]Leu15)-Teriparatide; H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-[13C6]Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; ([13C6]Leu15)-pTH (1-34) (human); L-seryl-L-valyl-L-seryl-L-α-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparaginyl-L-leucylglycyl-L-lysyl-L-histidyl-L-leucyl-[13C6]-L-asparaginyl-L-seryl-L-methionyl-L-α-glutamyl-L-arginyl-L-valyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-valyl-L-histidyl-L-asparaginyl-L-Phenylalanine; Parathar-13C6; Teriparatida-13C6; Forteo-13C6
Related CAS 52232-67-4 (unlabelled) 99294-94-7 (unlabelled acetate)
Purity ≥95%
Solubility Soluble in DMSO, Water
Appearance White Powder
Storage Store at -20°C
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Related Products
Levocetirizine-[d4](CAS: 1133210-23-7)

Levocetirizine-[d4] is the labelled analogue of Levocetirizine, which is a histamine H1 receptor antagonist and could be used as an antihystaminic agent.

Lamotrigine-[13C2,15N]

Lamotrigine-[13C2,15N] is the labelled analogue of Lamotrigine, which is used as a radiolabelled internal standard. Lamotrigine is an anticonvulsant, which inhi...

Etoposide-[d4]

Etoposide-[d4] is a deuterium labelled form of Etoposide, which is a cytotoxic anticancer drug which belongs to the topoisomerase inhibitor drug class.

Irbesartan-[d6]

Irbesartan-[d6] is an isotopically labelled analogue of Irbesartan, which is an angiotensin II type 1 (AII1)-receptor antagonist.

Banoxantrone-[d12] dihydrochloride(CAS: 1562066-98-1)

Banoxantrone-[d12] dihydrochloride is the labelled salt of Banoxantrone, which is a potent topoisomerase II inhibitor.

Famotidine-[13C]

Famotidine-[13C] is the labelled analogue of Famotidine. Famotidine is a histamine H2 receptor antagonist that inhibits stomach acid production. It can be used ...

Interested in our Service & Products?
Need detailed information?

USA
  • International:
  • US & Canada (Toll free):
  • Email:
  • Fax:
UK
  • Email:
Navigation
Copyright © 2024 BOC Sciences. All Rights Reserved.
Inquiry Basket
Loading ......
Delete selectedGo to checkout